PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun003825
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB
Protein Properties Length: 244aa    MW: 28070.3 Da    PI: 8.9685
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-34773PU_refplantGDBView CDS
gnl|UG|Vun#S45812331PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding54.23.3e-172067148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     rg+WT +Ed+ l+++++ +G g+W+t a   g++Rt+k+c++rw++yl
        Vun003825 20 RGPWTVDEDLTLINYIATHGEGRWNTLALSAGLKRTGKSCRLRWLNYL 67
                     89********************************************97 PP

2Myb_DNA-binding51.13.1e-1673116146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg+ T eE++l+++++ ++G++ W++Ia++++ gRt++++k++w++
        Vun003825  73 RGNITLEEQLLILELHSRWGNR-WSKIAQYLP-GRTDNEIKNYWRT 116
                      7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129416.0071567IPR017930Myb domain
SuperFamilySSF466891.24E-3017114IPR009057Homeodomain-like
SMARTSM007176.2E-141969IPR001005SANT/Myb domain
PfamPF002497.1E-162067IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.1E-212174IPR009057Homeodomain-like
CDDcd001674.28E-102267No hitNo description
PROSITE profilePS5129422.91768122IPR017930Myb domain
SMARTSM007172.9E-1472120IPR001005SANT/Myb domain
PfamPF002495.2E-1573116IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.6E-2275121IPR009057Homeodomain-like
CDDcd001671.02E-693116No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 244 aa     Download sequence    Send to blast
MDEKGRTTSL LSEDEMELRR GPWTVDEDLT LINYIATHGE GRWNTLALSA GLKRTGKSCR  60
LRWLNYLRPD VRRGNITLEE QLLILELHSR WGNRWSKIAQ YLPGRTDNEI KNYWRTRVQK  120
HAKQLKCDVN SKQFKDAMRY LWMPRLVERI QAAATATATT SVTTNDAYTS ENNLKNNHME  180
VHNNLKEKMG FIEPSPPMNN DFVASYVMQS HTPDNSSTAL SSSDSFGTQV STKSDLTDYY  240
SVPX
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-261711424120MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007158818.11e-142hypothetical protein PHAVU_002G184600g
SwissprotQ9LDE13e-90MY108_ARATH; Transcription factor MYB108
TrEMBLV7CKV21e-142V7CKV2_PHAVU; Uncharacterized protein
STRINGGLYMA17G04171.11e-115(Glycine max)
STRINGGLYMA07G36430.21e-115(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G06490.11e-85myb domain protein 108